PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028436m
Common NameCARUB_v10028436mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 244aa    MW: 27336.8 Da    PI: 5.2205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028436mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.6e-141565148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd  +  G +   +W+ +++  g++R++k+c++rw +yl
  Carubv10028436m 15 KGPWTAEEDGKLVDFLRTRGDRggwCWRDVPKLAGLRRCGKSCRLRWTNYL 65
                     79***********************************************97 PP

2Myb_DNA-binding55.11.8e-1771115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE +l +d++++lG++ W++Ia +++ gRt++++k++w+++
  Carubv10028436m  71 RGLFTEEEIQLVIDLHARLGNR-WSKIAIELP-GRTDNDIKNYWNTH 115
                      788*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-18668IPR009057Homeodomain-like
PROSITE profilePS5129412.8861065IPR017930Myb domain
SuperFamilySSF466892.88E-2412112IPR009057Homeodomain-like
SMARTSM007174.2E-71467IPR001005SANT/Myb domain
PfamPF002493.3E-121565IPR001005SANT/Myb domain
CDDcd001673.10E-51765No hitNo description
PROSITE profilePS5129427.06866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2569121IPR009057Homeodomain-like
SMARTSM007178.3E-1770118IPR001005SANT/Myb domain
PfamPF002496.0E-1671115IPR001005SANT/Myb domain
CDDcd001673.28E-1274116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGGRKPCCDE VGLRKGPWTA EEDGKLVDFL RTRGDRGGWC WRDVPKLAGL RRCGKSCRLR  60
WTNYLRPDLK RGLFTEEEIQ LVIDLHARLG NRWSKIAIEL PGRTDNDIKN YWNTHIKRKL  120
IRMGIDPNTH RRFEFNQQKV NEEEKVLLVN SPKPPSQPEV PLVLQNDTSA GNLNNLADVD  180
GDDDQPWSFL MENDGVVGGG GGAGELTMLL SGDISSSCSS SSSLWLKYGD LGYEDLELGC  240
FDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281312025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00577DAPTransfer from AT5G62320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1990260.0AF199026.2 Arabidopsis thaliana putative transcription factor (MYB99) mRNA, complete cds.
GenBankAY5196440.0AY519644.1 Arabidopsis thaliana MYB transcription factor (At5g62320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282174.11e-178hypothetical protein CARUB_v10028436mg
SwissprotQ50EX63e-67ODO1_PETHY; Protein ODORANT1
TrEMBLR0F0I21e-178R0F0I2_9BRAS; Uncharacterized protein
STRINGscaffold_802887.11e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62320.11e-132myb domain protein 99